(data stored in ACNUC7421 zone)

EMBL: D38161.PE13

D38161.PE13          Location/Qualifiers
FT   CDS             12107..12850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="regulatory protein for aceAB"
FT                   /db_xref="GOA:P42968"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42968"
FT                   /protein_id="BAA07362.1"
FT                   /translation="MMQNKNKTVVKSMALLNLFLHKPSLTLSELVSLTGMPKTSVHRMV
FT                   SSLEEMGFLSRDASGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIM
FT                   RDGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIEAYIKQTELIS
FT                   IGSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHERQVAAGISIAGFE
FT                   ARFTEDRLPYLTEKVKDAALQISRK"
     MMQNKNKTVV KSMALLNLFL HKPSLTLSEL VSLTGMPKTS VHRMVSSLEE MGFLSRDASG        60
     AYSLGLVFLE FGQLVADRLD IRKIAKPVME ELCREVDEAV QLIMRDGNEA IYVEKIEGTQ       120
     TVRLYTAIGR RSPLYAGACA RSILSFLPRE EIEAYIKQTE LISIGSGTIT DPEKLLQEID       180
     ASVQNGYTVS YSELENYTAA IGAPIFNHER QVAAGISIAG FEARFTEDRL PYLTEKVKDA       240
     ALQISRK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page