(data stored in ACNUC7421 zone)

EMBL: D38161.PE14

D38161.PE14          Location/Qualifiers
FT   CDS             12925..13566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /protein_id="BAA07363.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
     MVLRYTALGD SLTTGRGSGL FSPGFVQRFG DMMEADLKTR TAINIFARSG LNTEEILGLL        60
     SYPYVQKCIR DADMITITGC GNDLIDSVLA YQTSKDETIF SRVSAHCHEN FEKMIAKVAE       120
     IKGENPSPYA IRVFNLYNPF PEIDIAGKWI TSFNSHLETL ASAPHVKIAD AYSIFKGKEQ       180
     EYLSFDGVHP NSKGYQAMAE AVHKLGYKEL SVS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page