(data stored in ACNUC7421 zone)

EMBL: D38161.PE15

D38161.PE15          Location/Qualifiers
FT   CDS             13755..14069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /protein_id="BAA07364.1"
FT                   /translation="MSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERK
FT                   KENDGSGAFNIYTAVLYGLSPLSVLHFILYKSILHILKMLDRRERGIEPMKQGFPLLIL
FT                   "
     MSFAVIIIIL ALIAFNYTEH TSVIQSVMLV FLGAVMFMQG LEERKKENDG SGAFNIYTAV        60
     LYGLSPLSVL HFILYKSILH ILKMLDRRER GIEPMKQGFP LLIL                        104
//

If you have problems or comments...

PBIL Back to PBIL home page