(data stored in ACNUC7421 zone)

EMBL: D38161.PE16

D38161.PE16          Location/Qualifiers
FT   CDS             14425..16431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="GOA:P42971"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42971"
FT                   /protein_id="BAA07365.1"
FT                   /translation="MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDD
FT                   MYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVS
FT                   MNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIY
FT                   DKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSF
FT                   VPLKKVKPDQEKLVSEATSLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKE
FT                   GTYSDTSNIGIAGLENVYEDKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQ
FT                   MKLYDELKDDSGAAVALQPKTGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFS
FT                   AKFNKTYAPGSTIKPIAAAIGIKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQ
FT                   QVDLENALITSDNIYFAQNALDMGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDS
FT                   DILLADTGYGQGQMQMSPLHLATAYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEG
FT                   AADITKGLKGVVEDERGSAYQPVVKGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYE
FT                   NKDLLVAMMIQNVQDRGGSHYVVEKAKKQFQSN"
     MLKKCILLVF LCVGLIGLIG CSKTDSPEDR MEAFVKQWND QQFDDMYQSL TKDVKKEISK        60
     KDFVNRYKAI YEQAGVKNLK VTAGEVDKDD QDNKTMKHIP YKVSMNTNAG KVSFKNTAVL       120
     KLEKTDDEES WNIDWDPSFI FKQLADDKTV QIMSIEPKRG QIYDKNGKGL AVNTDVPEIG       180
     IVPGELGDKK EKVIKELAKK LDLTEDDIKK KLDQGWVKDD SFVPLKKVKP DQEKLVSEAT       240
     SLQGVTRTNV SSRYYPYGEK TAHLTGYVRA ITAEELKKKK EGTYSDTSNI GIAGLENVYE       300
     DKLRGTTGWK IYVPQTGEVI AEKKAKDGED LHLTIDIKTQ MKLYDELKDD SGAAVALQPK       360
     TGETLALVSA PSYDPNGFIF GWSDKEWKKL NKDKNNPFSA KFNKTYAPGS TIKPIAAAIG       420
     IKNGTLKADE KKTIKGKEWQ KDSSWGGYSV TRVSERLQQV DLENALITSD NIYFAQNALD       480
     MGADTFTKGL KTFGFSEDVP YEFPIQKSSI ANDKLDSDIL LADTGYGQGQ MQMSPLHLAT       540
     AYTPFVDNGD LVKPTLIKKD SQTADVWHKQ VVTKEGAADI TKGLKGVVED ERGSAYQPVV       600
     KGITVAGKTG TAELKTSKDD KDGTENGWFV GYDYENKDLL VAMMIQNVQD RGGSHYVVEK       660
     AKKQFQSN                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page