(data stored in ACNUC7421 zone)

EMBL: D38161.PE5

D38161.PE5           Location/Qualifiers
FT   CDS             5399..5845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JMQ0"
FT                   /protein_id="BAA07354.1"
FT                   /translation="MMKRVAYPGTVITNRSAHLRHTAAFPCDSSPHAESNHKDVPSGVL
FT                   PDHRLDDGFSRFQPFVFCKLFVCRFFFFQCVDFILAEQVGRQHIISSHFDQPAHLFHMA
FT                   VYTIYFVCENDKRFWEHNGLLLCFFHYILSFHFRLRYNGQKKEI"
     MMKRVAYPGT VITNRSAHLR HTAAFPCDSS PHAESNHKDV PSGVLPDHRL DDGFSRFQPF        60
     VFCKLFVCRF FFFQCVDFIL AEQVGRQHII SSHFDQPAHL FHMAVYTIYF VCENDKRFWE       120
     HNGLLLCFFH YILSFHFRLR YNGQKKEI                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page