(data stored in ACNUC7421 zone)

EMBL: D38161.PE6

D38161.PE6           Location/Qualifiers
FT   CDS             5847..6359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /protein_id="BAA07355.1"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEGLRKPRLLQELQMRTAWDYCLRKRKSWEKLCLVTGLILRLKSRAIGAGLC
FT                   SDMPRHQLESSLLLKLKSASILKNEKNPSQHFVRGSILCRNPVRFESYLFAGVCVFHHS
FT                   YFPSALH"
     MNSLSLPHRY PFLFIDGVTD SEPGKHAAAY KLISENDWFI TDTQTEMPFS LVIEGLRKPR        60
     LLQELQMRTA WDYCLRKRKS WEKLCLVTGL ILRLKSRAIG AGLCSDMPRH QLESSLLLKL       120
     KSASILKNEK NPSQHFVRGS ILCRNPVRFE SYLFAGVCVF HHSYFPSALH                  170
//

If you have problems or comments...

PBIL Back to PBIL home page