(data stored in ACNUC7421 zone)

EMBL: D38161.PE7

D38161.PE7           Location/Qualifiers
FT   CDS             6562..7311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="similar to hypothetical 29,7 kDa E. coli protein"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /protein_id="BAA07356.1"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKTKSSEITNS
FT                   SPTNIEVNALGINKAAAPCQGYGKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
     MSVQREDVDI KLIAIDMDGT LLNDEQLISD ENRKAIREAE DKGVYVVIST GRTLMTCREL        60
     AESLKLSSFL ITANGSEIWD SNFNLVERKL LHTDHIQMMW DLRNKHNTNF WASTVNKVWR       120
     GEFPENITDH EWLKFGFDIE DDDIRNEVLE ELRKTKSSEI TNSSPTNIEV NALGINKAAA       180
     PCQGYGKLGF TMENVMAMGD SLNDIAMIKE AGLGVAMGNA QDIVKETADY ITDTNIEDGV       240
     AKAIRHWVL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page