(data stored in ACNUC7421 zone)

EMBL: D38161.PE8

D38161.PE8           Location/Qualifiers
FT   CDS             7651..8151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lactam utilization protein"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /protein_id="BAA07357.1"
FT                   /translation="MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVY
FT                   QIGALSGFLKAEGLHMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESE
FT                   LVKAGERIGLQTANEVFADRTYQSDGTLTPAPSRTHSLKVMMPRHPGHQNGERRGGQIS
FT                   ARP"
     MRKTVALAAE RGVKMGAHPG LPDLLGFGRR NMAISPEEAY DLVVYQIGAL SGFLKAEGLH        60
     MQHVKPHGAL YNMAAVDQKL SDAIAKAVYK VDPGLILFGL AESELVKAGE RIGLQTANEV       120
     FADRTYQSDG TLTPAPSRTH SLKVMMPRHP GHQNGERRGG QISARP                      166
//

If you have problems or comments...

PBIL Back to PBIL home page