(data stored in ACNUC7421 zone)

EMBL: D38161.PE9

D38161.PE9           Location/Qualifiers
FT   CDS             8350..8688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07358.1"
FT                   /translation="MLMGAAFLMATSAIGPGFLTQTATFTNTLAASFGFVILISIILDI
FT                   FAQTNVWRIIAVSGKRGQEIANMVLPGLGYSIAILVVLGGLAFNIGNIGGAGWDFRCCS
FT                   ALHLKQAL"
     MLMGAAFLMA TSAIGPGFLT QTATFTNTLA ASFGFVILIS IILDIFAQTN VWRIIAVSGK        60
     RGQEIANMVL PGLGYSIAIL VVLGGLAFNI GNIGGAGWDF RCCSALHLKQ AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page