(data stored in SCRATCH zone)

EMBL: D49729.PE1

D49729.PE1           Location/Qualifiers
FT   CDS             289..1560
FT                   /codon_start=1
FT                   /product="V1a arginine vasopressin receptor"
FT                   /db_xref="GOA:Q62463"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62463"
FT                   /protein_id="BAA08566.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
     MSFPRGSHDL PAGNSSPWWP LTTEGANSSR EAAGLGEGGS PPGDVRNEEL AKLEVTVLAV        60
     IFVVAVLGNS SVLLALHRTP RKTSRMHLFI RHLSLADLAV AFFQVLPQLC WDITYRFRGP       120
     DWLCRVVKHL QVFAMFASSY MLVVMTADRY IAVCHPLKTL QQPARRSRLM IAASWGLSFV       180
     LSIPQYFIFS VIEFEVNNGT KAQDCWATFI PPWGTRAYVT WMTSGVFVVP VIILGTCYGF       240
     ICYHIWRNVR GKTASRQSKG GKGSGEAAGP FHKGLLVTPC VSSVKSISRA KIRTVKMTFV       300
     IVSAYILCWT PFFIVQMWSV WDTNFVWTDS ENPSTTITAL LASLNSCCNP WIYMFFSGHL       360
     LQDCVQSFPC CQSIAQKFAK DDSDSMSRRQ TSYSNNRSPT NSTGTWKDSP KSSKSIRFIP       420
     VST                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page