(data stored in ACNUC23119 zone)

EMBL: EF094467.VASA

EF094467.VASA        Location/Qualifiers
FT   CDS             157..>1638
FT                   /codon_start=1
FT                   /gene="vasa"
FT                   /product="vasa-like protein"
FT                   /note="ATP-dependent RNA helicase; Apvasa; similar to
FT                   Drosophila vasa"
FT                   /db_xref="GOA:A4UF97"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4UF97"
FT                   /protein_id="ABO15582.1"
FT                   /translation="MSDGGWDDESGSSNQRGRGRGGNRGGGRGRGNCNNRNNDDFDSAS
FT                   QGDSWGNGGGSSEWGTNDDGDRDGGSRGRGGRGGRGRGGRGGGRNMDRSNGDEDGGDGN
FT                   FGGDDGEAPVNDKPRPTYIPPEIDENDVYGIGVGSNFNKYENIEVKVSGDNVPKHIESF
FT                   KSSGLREVLIEKLVKCNYTTPTPIQKYCIPVIISGRDMMATAQTGSGKTAAFVLPIVHT
FT                   LLSQPQDLVFDRDYCEPQCIIMSPTRELAIQIRDVVFKLTNGTCIKQSILYGGTATGHQ
FT                   RGTLANGIHILVATPGRLNDFVGRGYVSFNSLRFFVLDEADRMLDMGFKPDIEKILNHE
FT                   TMVDVNTRQTLLFSATLADDIQMLSKAYLKPNYVFVAVGEIGGACKDVKQEIREVTKFE
FT                   KKKELIKVLESLGDCKGTMVFVEQKRNADFIAAFLSEKDYPTTSIHGDREQPEREQALR
FT                   DFKNNRMKILVATAVAARGLDIKGVNCVINFDMPSS"
     MSDGGWDDES GSSNQRGRGR GGNRGGGRGR GNCNNRNNDD FDSASQGDSW GNGGGSSEWG        60
     TNDDGDRDGG SRGRGGRGGR GRGGRGGGRN MDRSNGDEDG GDGNFGGDDG EAPVNDKPRP       120
     TYIPPEIDEN DVYGIGVGSN FNKYENIEVK VSGDNVPKHI ESFKSSGLRE VLIEKLVKCN       180
     YTTPTPIQKY CIPVIISGRD MMATAQTGSG KTAAFVLPIV HTLLSQPQDL VFDRDYCEPQ       240
     CIIMSPTREL AIQIRDVVFK LTNGTCIKQS ILYGGTATGH QRGTLANGIH ILVATPGRLN       300
     DFVGRGYVSF NSLRFFVLDE ADRMLDMGFK PDIEKILNHE TMVDVNTRQT LLFSATLADD       360
     IQMLSKAYLK PNYVFVAVGE IGGACKDVKQ EIREVTKFEK KKELIKVLES LGDCKGTMVF       420
     VEQKRNADFI AAFLSEKDYP TTSIHGDREQ PEREQALRDF KNNRMKILVA TAVAARGLDI       480
     KGVNCVINFD MPSS                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page