(data stored in ACNUC7421 zone)

EMBL: EU895932

EU895932             Location/Qualifiers
FT   CDS             1..828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs3789"
FT                   /product="putative enzyme"
FT                   /note="similar to putative enzyme, Escherichia coli O157
FT                   Sakai ECs3789"
FT                   /db_xref="GOA:C3SVK2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3SVK2"
FT                   /protein_id="ACI78493.1"
FT                   /translation="MNLSRRNILIKGIFMSYQYVNVVTINKVAVIEFNYGRKLNALSKV
FT                   FIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITR
FT                   MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLT
FT                   RDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
FT                   IKEELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFVGH"
     MNLSRRNILI KGIFMSYQYV NVVTINKVAV IEFNYGRKLN ALSKVFIDDL MQALSDLNRP        60
     EIRCIILRAP SGSKVFSAGH DIHELPSGGR DPLSYDDPLR QITRMIQKFP KPIISMVEGS       120
     VWGGAFEMIM SSDLIIAAST STFSMTPVNL GVPYNLVGIH NLTRDAGFHI VKELIFTASP       180
     ITAQRALAVG ILNHVVEVEE LEDFTLQMAH HISEKAPLAI AVIKEELRVL GEAHTMNSDE       240
     FERIQGMRRA VYDSEDYQEG MNAFLEKRKP NFVGH                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page