(data stored in ACNUC7421 zone)

EMBL: FM180568.ACCA

FM180568.ACCA        Location/Qualifiers
FT   CDS             218622..219581
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="E2348C_0190"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07738"
FT                   /db_xref="GOA:B7UJ86"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJ86"
FT                   /protein_id="CAS07738.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLSVPTICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
     MSLNFLDFEQ PIAELEAKID SLTAVSRQDE KLDINIDEEV HRLREKSVEL TRKIFADLGA        60
     WQIAQLARHP QRPYTLDYVR LAFDEFDELA GDRAYADDKA IVGGIARLDG RPVMIIGHQK       120
     GRETKEKIRR NFGMPAPEGY RKALRLMQMA ERFKMPIITF IDTPGAYPGV GAEERGQSEA       180
     IARNLREMSR LSVPTICTVI GEGGSGGALA IGVGDKVNML QYSTYSVISP EGCASILWKS       240
     ADKAPLAAEA MGIIAPRLKE LKLIDSIIPE PLGGAHRNPE AMAASLKAQL LADLADLDVL       300
     STEDLKNRRY QRLMSYGYA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page