(data stored in ACNUC7421 zone)

EMBL: FM180568.ACPH

FM180568.ACPH        Location/Qualifiers
FT   CDS             complement(383380..383961)
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="E2348C_0339"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07887"
FT                   /db_xref="GOA:B7UJM7"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJM7"
FT                   /protein_id="CAS07887.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRNETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFTCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQSVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMEQASRKAL"
     MNFLAHLHLA HLAESSLSGN LLADFVRGNP EESFPPDVVA GIHMHRRIDV LTDNLPEVRE        60
     AREWFRNETR RVAPITLDVM WDHFLSRHWS QLSPDFPLQE FTCYAREQVM TILPDSPPRF       120
     INLNNYLWSE QWLVRYRDMD FIQSVLNGMA SRRPRLDALR DSWYDLDAHY DALETRFWQF       180
     YPRMMEQASR KAL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page