(data stored in ACNUC7421 zone)

EMBL: FM180568.AHPC

FM180568.AHPC        Location/Qualifiers
FT   CDS             569752..570315
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="E2348C_0508"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08056"
FT                   /db_xref="GOA:B7UKP9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP9"
FT                   /protein_id="CAS08056.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
     MSLINTKIKP FKNQAFKNGE FIEITEKDTE GRWSVFFFYP ADFTFVCPTE LGDVADHYEE        60
     LQKLGVDVYA VSTDTHFTHK AWHSSSETIA KIKYAMIGDP TGALTRNFDN MREDEGLADR       120
     ATFVVDPQGI IQAIEVTAEG IGRDASDLLR KIKAAQYVAS HPGEVCPAKW KEGEATLAPS       180
     LDLVGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page