(data stored in ACNUC7421 zone)

EMBL: FM180568.AMPE

FM180568.AMPE        Location/Qualifiers
FT   CDS             125280..126134
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="E2348C_0114"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07662"
FT                   /db_xref="GOA:B7UIF9"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF9"
FT                   /protein_id="CAS07662.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRTLQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     MTLFTTLLVL IFERLFKLGE HWQLDHRLEA FFRRVKHFSL GRTLGMTIIA MGVTFLLLRT        60
     LQGVLFNVPT LLVWLLIGLL CIGAGKVRLH YHAYLTAASR NDSHARATMA GELTMIHGVP       120
     AGCDEREYLR ELQNALLWIN FRFYLAPLFW LIVGGTWGPV TLMGYAFLRA WQYWLARYQT       180
     PHHRLQSGID AVLHVLDWVP VRLAGVVYAL IGHGEKALPA WFASLGDFHT SQYQVLTRLA       240
     QFSLAREPHV DKVETPKAAV SMAKKTSFVV VVVIALLTIY GALV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page