(data stored in ACNUC7421 zone)

EMBL: FM180568.AROM

FM180568.AROM        Location/Qualifiers
FT   CDS             366584..367261
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="E2348C_0326"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07874"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL4"
FT                   /protein_id="CAS07874.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVTVLLSNVLIARLAAE
FT                   LLV"
     MSASLAILTI GIVPMQEVLP LLTEYIDEDN ISHHSLLGKL SREEVMAEYA PEAGEDTILT        60
     LLNDNQLAHV SRRKVERDLQ GVVEVLDNQG YDVIILMSTA NISSMTARNT IFLEPSRILP       120
     PLVSSIVEDH QVGVIVPVEE LLTVQAQKWQ ILQKPPVFSL GNPIHDSEQK IIDAGKELLA       180
     KGADVIMLDC LGFNQRHRDL LQKQLDVTVL LSNVLIARLA AELLV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page