(data stored in ACNUC7421 zone)

EMBL: FM180568.BRNQ

FM180568.BRNQ        Location/Qualifiers
FT   CDS             378634..379953
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="E2348C_0336"
FT                   /product="predicted branched chain amino acid transporter
FT                   (LIV-II)"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07884"
FT                   /db_xref="GOA:B7UJM4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJM4"
FT                   /protein_id="CAS07884.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIIWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
     MTHQLRSRDI IALGFMTFAL FVGAGNIIFP PMVGLQAGEH VWTAAFGFLI TAVGLPVLTV        60
     VALAKVGGGV DSLSTPIGKV AGVLLATVCY LAVGPLFATP RTATVSFEVG IAPLTGDSAL       120
     PLFIYSLVYF AIVILVSLYP GKLLDTVGNF LAPLKIIALV ILSVAAIIWP AGSISTATEA       180
     YQNAAFSNGF VNGYLTMDTL GAMVFGIVIV NAARSRGVTE ARLLTRYTVW AGLMAGVGLT       240
     LLYLALFRLG SDSASLVDQS ANGAAILHAY VQHTFGGGGS FLLAALIFIA CLVTAVGLTC       300
     ACAEFFAQYV PLSYRTLVFI LGGFSMVVSN LGLSQLIQIS VPVLTAIYPP CIALVVLSFT       360
     RSWWHNSSRV IAPPMFISLL FGILDGIKAS AFSDILPSWA QRLPLAEQGL AWLMPTVVMV       420
     VLAIIWDRAA GRQVTSSAH                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page