(data stored in ACNUC7421 zone)

EMBL: FM180568.BTUF

FM180568.BTUF        Location/Qualifiers
FT   CDS             complement(188422..189222)
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="E2348C_0165"
FT                   /product="vitamin B12 transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07713"
FT                   /db_xref="GOA:B7UIK5"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIK5"
FT                   /protein_id="CAS07713.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEKAAQSLLDQYAQLKAQYADKSKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
     MAKSLFRALV ALSFLAPLWL YAAPRVITLS PANTELAFAA GITPVGVSSY SDYPPQAQKI        60
     EQVSTWQGMN LERIVALKPD LVIAWRGGNA ERQVDQLASL GIKVMWVDAT SIEQIANALR       120
     QLAPWSPQPD KAEKAAQSLL DQYAQLKAQY ADKSKKRVFL QFGINPPFTS GKESIQNQVL       180
     EVCGGENIFK DSRVPWPQVS REQVLARSPQ AIVITGGPDQ IPKIKQYWGE QLKIPVIPLT       240
     SDWFERASPR IILAAQQLCN ALSQVD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page