(data stored in ACNUC7421 zone)

EMBL: FM180568.CRCB

FM180568.CRCB        Location/Qualifiers
FT   CDS             complement(586941..587324)
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="E2348C_0525"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08073"
FT                   /db_xref="GOA:B7UKR6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKR6"
FT                   /protein_id="CAS08073.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLAA NLIGAFIIGM GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page