(data stored in ACNUC7421 zone)

EMBL: FM180568.CUSB

FM180568.CUSB        Location/Qualifiers
FT   CDS             529812..531035
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="E2348C_0474"
FT                   /product="copper/silver efflux system, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08022"
FT                   /db_xref="GOA:B7UKL6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL6"
FT                   /protein_id="CAS08022.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKEEPPAEKTSTAERKVLFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFSQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGNEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
     MKKIALIIGS MIAGGIISAA GFTWFAKEEP PAEKTSTAER KVLFWYDPMY PNTRFDKPGK        60
     SPFMDMDLVP KYADEESSAS GVRIDPTQTQ NLGVKTATVT RGPLTFSQSF PANVSYNEYQ       120
     YAIVQARAAG FIDKVYPLTV GDKVQKGAPL LDLTIPDWVE AQSEYLLLRE TGGTATQTEG       180
     ILERLRLAGM PEADIRRLIA TQKIQTRFTL KAPIDGVITA FDLRAGMNIA KDNVVAKIQG       240
     MDPVWVTAAI PESIAWLVKD ASQFTLTVPA RPDKTLTIRK WTLLPGVDAA TRTLQLRLEV       300
     DNADEALKPG MNAWLQLNTA SEPMLLIPSQ ALIDTGNEQR VITVDADGRF VPKRVAVFQA       360
     SQGVTALRSG LAEGEKVVSS GLFLIDSEAN ISGALERMRS ESATHAH                     407
//

If you have problems or comments...

PBIL Back to PBIL home page