(data stored in ACNUC7421 zone)

EMBL: FM180568.CUSF

FM180568.CUSF        Location/Qualifiers
FT   CDS             529464..529796
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="E2348C_0473"
FT                   /product="periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08021"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL5"
FT                   /protein_id="CAS08021.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GVDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     MKKALQVAMF SLFTVIGFNA QANEHHHETM SEAQPQVISA TGVVKGVDLE SKKITIHHDP        60
     IAAVNWPEMT MRFTITPQTK MSEIKTGDKV AFNFVQQGNL SLLQDIKVSQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page