(data stored in ACNUC7421 zone)

EMBL: FM180568.CUSS

FM180568.CUSS        Location/Qualifiers
FT   CDS             complement(525786..527228)
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="E2348C_0470"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08018"
FT                   /db_xref="GOA:B7UKL2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL2"
FT                   /protein_id="CAS08018.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDTRGGEVYLLSGPTIMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVHYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDECQVAGDPLMLRRALSNLLSNALRYTPTGETIVV
FT                   RCQTVDHLVQVTVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVIILPA"
     MVSKPFQRPF SLATRLTFFI SLATIAAFFA FAWIMIHSVK VHFAEQDIND LKEISATLER        60
     VLNHPDETQA RRLMTLEDIV SGYSNVLISL ADSHGKTVYH SPGAPDIREF ARDAIPDKDT       120
     RGGEVYLLSG PTIMMPGHGH GHMEHSNWRM ISLPVGPLVD GKPIYTLYIA LSIDFHLHYI       180
     NDLMNKLIMT ASVISILIVF IVLLAVHKGH APIRSVSRQI QNITSKDLDV RLDPQTVPIE       240
     LEQLVLSFNH MIERIEDVFT RQSNFSADIA HEIRTPITNL ITQTEIALSQ SRSQKELEDV       300
     HYSNLEELTR MAKMVSDMLF LAQADNNQLI PEKKMLNLAD EVGKVFDFFE ALAEDRGVEL       360
     RFVGDECQVA GDPLMLRRAL SNLLSNALRY TPTGETIVVR CQTVDHLVQV TVENPGTPIA       420
     PEHLPRLFDR FYRVDPSRQR KGEGSGIGLA IVKSIVVAHK GTVAVTSDAR GTRFVIILPA       480
//

If you have problems or comments...

PBIL Back to PBIL home page