(data stored in ACNUC7421 zone)

EMBL: FM180568.CYDB

FM180568.CYDB        Location/Qualifiers
FT   CDS             686975..688114
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="E2348C_0617"
FT                   /product="cytochrome d terminal oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08165"
FT                   /db_xref="GOA:B7ULL3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL3"
FT                   /protein_id="CAS08165.1"
FT                   /translation="MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGF
FT                   DYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQ
FT                   LLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWV
FT                   MYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTIL
FT                   TARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVM
FT                   TWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY"
     MIDYEVLRFI WWLLVGVLLI GFAVTDGFDM GVGMLTRFLG RNDTERRIMI NSIAPHWDGN        60
     QVWLITAGGA LFAAWPMVYA AAFSGFYVAM ILVLASLFFR PVGFDYRSKI EETRWRNMWD       120
     WGIFIGSFVP PLVIGVAFGN LLQGVPFNVD EYLRLYYTGN FFQLLNPFGL LAGVVSVGMI       180
     ITQGATYLQM RTVGELHLRT RATAQVAALV TLVCFALAGV WVMYGIDGYV VKSTMDHYAA       240
     SNPLNKEVVR EAGAWLVNFN NTPILWAIPA LGVVLPLLTI LTARMDKAAW AFVFSSLTLA       300
     CIILTAGIAM FPFVMPSSTM MNASLTMWDA TSSQLTLNVM TWVAVVLVPI ILLYTAWCYW       360
     KMFGRITKED IERNTHSLY                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page