(data stored in ACNUC7421 zone)

EMBL: FM180568.CYOC

FM180568.CYOC        Location/Qualifiers
FT   CDS             complement(406950..407564)
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="E2348C_0365"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07913"
FT                   /db_xref="GOA:B7UJQ3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJQ3"
FT                   /protein_id="CAS07913.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVVSWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     MATDTLTHAT AHAHEHGHHD AGGTKIFGFW IYLMSDCILF SILFATYAVL VNGTAGGPTG        60
     KDIFELPFVL VETFLLLFSS ITYGMAAIAM YKNNKSQVVS WLALTWLFGA GFIGMEIYEF       120
     HHLIVNGMGP DRSGFLSAFF ALVGTHGLHV TSGLIWMAVL MVQIARRGLT STNRTRIMCL       180
     SLFWHFLDVV WICVFTVVYL MGAM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page