(data stored in ACNUC7421 zone)

EMBL: FM180568.DJLA

FM180568.DJLA        Location/Qualifiers
FT   CDS             60801..61616
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="E2348C_0058"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07606"
FT                   /db_xref="GOA:B7UIA3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIA3"
FT                   /protein_id="CAS07606.1"
FT                   /translation="MQYWGKIIGVAVALIMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
     MQYWGKIIGV AVALIMGGGF WGVVLGLLIG HMFDKARSRK MAWFANQRER QALFFATTFE        60
     VMGHLTKSKG RVTEADIHIA SQLMDRMNLH GASRTAAQNA FRVGKSDNYP LREKMRQFRS       120
     VCFGRFDLIR MFLEIQIQAA FADGSLHPNE RAVLYVIAEE LGISRAQFDQ FLRMMQGGAQ       180
     FGGGYQQQSG GGNWQQAQRG PTLEDACNVL GVKPTDDATT IKRAYRKLMS EHHPDKLVAK       240
     GLPPEMMEMA KQKAQEIQQA YELIKQQKGF K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page