(data stored in ACNUC7421 zone)

EMBL: FM180568.DKSA

FM180568.DKSA        Location/Qualifiers
FT   CDS             complement(165973..166428)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="E2348C_0148"
FT                   /product="DNA-binding transcriptional regulator of rRNA
FT                   transcription, DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07696"
FT                   /db_xref="GOA:B7UII9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII9"
FT                   /protein_id="CAS07696.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
     MQEGQNRKTS SLSILAIAGV EPYQEKPGEE YMNEAQLAHF RRILEAWRNQ LRDEVDRTVT        60
     HMQDEAANFP DPVDRAAQEE EFSLELRNRD RERKLIKKIE KTLKKVEDED FGYCESCGVE       120
     IGIRRLEARP TADLCIDCKT LAEIREKQMA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page