(data stored in ACNUC7421 zone)

EMBL: FM180568.DNAQ

FM180568.DNAQ        Location/Qualifiers
FT   CDS             246248..246979
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="E2348C_0215"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07763"
FT                   /db_xref="GOA:B7UJB1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJB1"
FT                   /protein_id="CAS07763.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNATFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEL
FT                   AAHEARLDLVQKKGGTCLWRA"
     MSTAITRQIV LDTETTGMNQ IGAHYEGHKI IEIGAVEVVN RRLTGNNFHV YLKPDRLVDP        60
     EAFGVHGIAD EFLLDKPTFA EVADEFMDYI RGAELVIHNA TFDIGFMDYE FSLLKRDIPK       120
     TNTFCKVTDS LAVARKMFPG KRNSLDALCA RYEIDNSKRT LHGALLDAQI LAEVYLAMTG       180
     GQTSMAFAME GETQQQQGEA TIQRIVRQAS KLRVVFATDE ELAAHEARLD LVQKKGGTCL       240
     WRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page