(data stored in ACNUC7421 zone)

EMBL: FM180568.FDRA

FM180568.FDRA        Location/Qualifiers
FT   CDS             504544..506211
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="E2348C_0451"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07999"
FT                   /db_xref="GOA:B7UKJ5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ5"
FT                   /protein_id="CAS07999.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAVMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSASQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAATPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAETVRLKIVNAMKATGKT
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHQHGMMLDADGHQILDLGDDFYTVGRPHPMIDPTLRNL
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRAQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
     MIHAFIKKGC FQDSVSLMII SRKLSESENV DDVSVMMGTP ANKALLDTTG FWHDDFNNAT        60
     PNDICVAIRS EAADAGIAQA VMQQLEEALK QLAQGSGSSQ ALTQVRRWDS ASQKLPDANL       120
     ALISVAGEYA AELANQALDR NLNVMMFSDN VTLEDEIQLK TRAREKGLLV MGPDCGTSMI       180
     AATPLAFANV MPEGNIGVIG ASGTGIQELC SQIALAGEGI THAIGLGGRD LSREVGGISA       240
     LTALEMLSAD EKSEVLAFVS KPPAETVRLK IVNAMKATGK TTVALFLGYT PAVARDENVW       300
     FASSLDEAAR LACLLSRVTA RRNAIAPASS GFICGLYTGG TLAAEAAGLL AGHLGVEADD       360
     THQHGMMLDA DGHQILDLGD DFYTVGRPHP MIDPTLRNLL IADLGAKPQV RVLLLDVVIG       420
     FGATADPAAS LVSAWQKACA ARSDNQPLYA IATVTGTERD PQCRAQQIAT LEDAGIAVVS       480
     SLPEATLLAA ALIHPLSPAT QQHTPSLLEN VAVINIGLRS FALELQSASK PVVHYQWSPV       540
     AGGNKKLARL LERLQ                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page