(data stored in ACNUC7421 zone)

EMBL: FM180568.FEPC

FM180568.FEPC        Location/Qualifiers
FT   CDS             complement(550451..551266)
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="E2348C_0490"
FT                   /product="iron-enterobactin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08038"
FT                   /db_xref="GOA:B7UKN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKN1"
FT                   /protein_id="CAS08038.1"
FT                   /translation="MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEDAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTAKI"
     MTESVARLRG EQLTLGYGKY TVAENLTVEI PDGHFTAIIG PNGCGKSTLL RTLSRLMTPA        60
     HGHVWLDGEH IQHYASKEVA RRIGLLAQNA TTPGDITVQE LVARGRYPHQ PLFTRWRKED       120
     EDAVTKAMQA TGITHLADQS VDTLSGGQRQ RAWIAMVLAQ ETAIMLLDEP TTWLDISHQI       180
     DLLELLSELN REKGYTLAAV LHDLNQACRY ASHLIALREG KIVAQGAPKE IVTAELIERI       240
     YGLRCMIIDD PVAGTPLVVP LGRTAPSTAK I                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page