(data stored in ACNUC7421 zone)

EMBL: FM180568.FEPG

FM180568.FEPG        Location/Qualifiers
FT   CDS             complement(551263..552255)
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="E2348C_0491"
FT                   /product="ferric enterobactin transport protein FepG;
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08039"
FT                   /db_xref="GOA:B7UKN2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKN2"
FT                   /protein_id="CAS08039.1"
FT                   /translation="MIYVSRRLIITCLLLLIACVMAGVWGLRSGAVTLETSQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLVADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     MIYVSRRLII TCLLLLIACV MAGVWGLRSG AVTLETSQVF AALMGDAPRS MTMVVTEWRL        60
     PRVLMALLIG AALGVSGAIF QSLMRNPLGS PDVMGFNTGA WSGVLVAMVL FGQDLTAIAL       120
     AAMVGGIVTS LLVWLLAWRN GIDTFRLIII GIGVRAMLVA FNTWLLLKAS LETALTAGLW       180
     NAGSLNGLTW AKTSPSAPII ILMLIAAALL VRRMRLLEMG DDTACALGVS VERSRLLMML       240
     VAVVLTAAAT ALAGPISFIA LVAPHIARRI SGTARWGLTQ AALCGALLLL VADLCAQQLF       300
     MPYQLPVGVV TVSLGGIYLI VLLIQESRKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page