(data stored in ACNUC7421 zone)

EMBL: FM180568.FHUC

FM180568.FHUC        Location/Qualifiers
FT   CDS             180661..181458
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="E2348C_0158"
FT                   /product="iron-hydroxamate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07706"
FT                   /db_xref="GOA:B7UIJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ8"
FT                   /protein_id="CAS07706.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
     MQEYTNHSDT TFALRNISFR VPGRTLLHPL SLTFPAGKVT GLIGHNGSGK STLLKMLGRH        60
     QPPSEGEILL DAQPLESWSS KAFARKVAYL PQQLPPAEGM TVRELVAIGR YPWHGALGRF       120
     GAADREKVEE AISLVGLKPL AHRLVDSLSG GERQRAWIAM LVAQDSRCLL LDEPTSALDI       180
     AHQVDVLALV HRLSQERGLT VIAVLHDINM AARYCDYLVA LRGGEMIAQG TPAEIMRGET       240
     LEMIYGIPMG ILPHPAGAAP VSFVY                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page