(data stored in ACNUC7421 zone)

EMBL: FM180568.FHUD

FM180568.FHUD        Location/Qualifiers
FT   CDS             181458..182348
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="E2348C_0159"
FT                   /product="iron-hydroxamate transporter subunit FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07707"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ9"
FT                   /protein_id="CAS07707.1"
FT                   /translation="MSGLPLISRRRLLTTMALSPLLWQMNTAHAAVIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLTHYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAVYKDVDVLCFDHDNSKDVDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRILDNAIGGKA"
     MSGLPLISRR RLLTTMALSP LLWQMNTAHA AVIDPNRIVA LEWLPVELLL ALGIVPYGVA        60
     DTINYRLWVS EPPLPDSVID VGLRTEPNLE LLTEMKPSFM VWSAGYGPSP EMLARIAPGR       120
     GFNFSDGKQP LAMARKSLTE MADLLNLQSA AETHLTHYED FIRSMKPRFV KRGARPLLLT       180
     TLIDPRHMLV FGPNSLFQEI LDEYGIPNAW QGETNFWGST AVSIDRLAVY KDVDVLCFDH       240
     DNSKDVDALM ATPLWQAMPF VRAGRFQRVP AVWFYGATLS AMHFVRILDN AIGGKA           296
//

If you have problems or comments...

PBIL Back to PBIL home page