(data stored in ACNUC7421 zone)

EMBL: FM180568.FIXX

FM180568.FIXX        Location/Qualifiers
FT   CDS             48337..48624
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="E2348C_0045"
FT                   /product="predicted 4Fe-4S ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07593"
FT                   /db_xref="GOA:B7UI90"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI90"
FT                   /protein_id="CAS07593.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
     MTSPVNVDVK LGVNKFNVDE EHPHIVVKAD ADKQALELLV KACPAGLYKK QDDGSVRFDY        60
     AGCLECGTCR ILGLGSALEQ WEYPRGTFGV EFRYG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page