(data stored in ACNUC7421 zone)

EMBL: FM180568.FTSL

FM180568.FTSL        Location/Qualifiers
FT   CDS             97149..97514
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="E2348C_0088"
FT                   /product="membrane-bound cell division protein at septum
FT                   containing leucine zipper motif"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07636"
FT                   /db_xref="GOA:B7UID3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B7UID3"
FT                   /protein_id="CAS07636.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page