(data stored in ACNUC7421 zone)

EMBL: FM180568.GLXK

FM180568.GLXK        Location/Qualifiers
FT   CDS             499851..500996
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="E2348C_0447"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07995"
FT                   /db_xref="GOA:B7UKJ1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ1"
FT                   /protein_id="CAS07995.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDAHYICLPIADGG
FT                   EGTVEAMVAATDGNIVKLEVCGPMGETVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQPLAA
FT                   NGGNLARVASIEMNECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQLTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     MKIVIAPDSF KESLSAEKCC QAIKAGFSTL FPDAHYICLP IADGGEGTVE AMVAATDGNI        60
     VKLEVCGPMG ETVNAFYGLT GDGKTAVIEM AAASGLMLVA PEKRNPLLAS SFGTGELIRH       120
     ALDNGIRHII LGIGGSATVD GGMGMAQALG VRFLDADGQP LAANGGNLAR VASIEMNECD       180
     PRLANCHIEV ACDVDNPLVG ARGAAAVFGP QKGATPEMVE ELEQGLQNYA RVLQQLTEIN       240
     VCQMAGGGAA GGMGIAAAVF LNADIKPGIE IVLNAVNLAQ AVQGAALVIT GEGRIDSQTA       300
     GGKAPLGVAS VAKQFNVPVI GIAGVLGDGV EVVHQYGIDA VFSILPRLAP LAEVLASGET       360
     NLFNSARNIA CAIKIGQGIK N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page