(data stored in ACNUC7421 zone)

EMBL: FM180568.HOFC

FM180568.HOFC        Location/Qualifiers
FT   CDS             complement(120520..121722)
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="E2348C_0109"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07657"
FT                   /db_xref="GOA:B7UIF4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIF4"
FT                   /protein_id="CAS07657.1"
FT                   /translation="MASKQLWRWRGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGVAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLASFSGEWGWLLVL
FT                   FGFLLAIANKLLMRHPTRLIARQKLLLRIPIMGSLMRGQKLTQIFTILTLTQSAGISFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MASKQLWRWR GITGDGNAQD GMLWAESRAL LLMALQQQMV TPLSLKRIAI NSAQWRGDKS        60
     AEVIHQLATL LKAGLTLSEG LALLAEQHPS KQWQALLQSL AHDLEQGVAF SNALLPWSEV       120
     FPPLYQAMIR TGELTGKLDE CCFELARQQK AQRQLTDKVK SALRYPIIIL AMAIMVVVAM       180
     LHFVLPEFAA IYKTFNTPLP ALTQGIMTLA SFSGEWGWLL VLFGFLLAIA NKLLMRHPTR       240
     LIARQKLLLR IPIMGSLMRG QKLTQIFTIL TLTQSAGISF LQGVESVRET MRCPYWVQLL       300
     TQIQHDISNG HPIWLALKNA GEFSPLCLQL VRTGEASGSL DLMLDNLAHH HRDNTMALAD       360
     NLAALLEPAL LIITGGIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page