(data stored in ACNUC7421 zone)

EMBL: FM180568.HTRE

FM180568.HTRE        Location/Qualifiers
FT   CDS             complement(158655..161243)
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="E2348C_0142"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07690"
FT                   /db_xref="GOA:B7UII4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B7UII4"
FT                   /protein_id="CAS07690.1"
FT                   /translation="MTIKSTNHLTHIATFCALLYSNSALCAELVEYDHTFLMGNDASNI
FT                   DLSRYTEGNPTLPGIYDVSVYINDQPIMSQSIAFTVIEGKKNAQACITQKNLLQFHISS
FT                   PDKNSGKAILLKRDDDLGDCLNLAEMISQSSIRYDVNDQRLDIDVPQAWIMKNYQNYVD
FT                   PSLWENGINAAMLSYNLNGYHSESPGRTNDSIYAAFNGGINLGAWRLRASGNYNWMTNV
FT                   HSDYDFQNRYLQRDLASLRSQLVIGESYTTGETFDSVSIRGIRLYSDSRMLPPVLASFA
FT                   PIIHGVANTNAKVTVMQNGYKIYETTVPPGAFAIDDLSPSGYGSDLIVTIEEADGTKRT
FT                   FSQPFSSVVQMLRPGVGRWDISAGQVLKDSIQDEPNLFQASYYYGLNNYLTGYTGIQLT
FT                   DNNYTAGLLGLGMNTPVGAFSVDVTHSNVSIPDDKTYQGQSYRISWNKLFENTSTSLNI
FT                   AAYRYSTQHYLGLNDALTLIDEVEHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFEKKD
FT                   YGSFYLSGSWSDYWASGQNSTNYSIGYSNSASWGSYSISAQRSLNEDGQTDDSIYLSFT
FT                   IPIENLLDTDHRSSGFQSIDTQLNSDFKGNNQLNISSSGYSDTNRISYSVNTGYMMNKS
FT                   SDDLSYIGGHASYESPWGTLSCSASASSDNSRQFSLNTDGGFVLHSGGLTFSNDSFSDS
FT                   DTLAVIQALGAKGARINYGNSTVDRWSYGVTSALSPYHENRIALDINDLENDVELKSTS
FT                   TVAIPRQGAVVFADFETVQGQSAIMNIVRSDGKNIPFAEDIYDEQNNIIGNVGQGGQAF
FT                   VHGIEQEENIRITWIEEGKPVSCFAHYQQNTASEKIAQSIILNGLRCQIQ"
     MTIKSTNHLT HIATFCALLY SNSALCAELV EYDHTFLMGN DASNIDLSRY TEGNPTLPGI        60
     YDVSVYINDQ PIMSQSIAFT VIEGKKNAQA CITQKNLLQF HISSPDKNSG KAILLKRDDD       120
     LGDCLNLAEM ISQSSIRYDV NDQRLDIDVP QAWIMKNYQN YVDPSLWENG INAAMLSYNL       180
     NGYHSESPGR TNDSIYAAFN GGINLGAWRL RASGNYNWMT NVHSDYDFQN RYLQRDLASL       240
     RSQLVIGESY TTGETFDSVS IRGIRLYSDS RMLPPVLASF APIIHGVANT NAKVTVMQNG       300
     YKIYETTVPP GAFAIDDLSP SGYGSDLIVT IEEADGTKRT FSQPFSSVVQ MLRPGVGRWD       360
     ISAGQVLKDS IQDEPNLFQA SYYYGLNNYL TGYTGIQLTD NNYTAGLLGL GMNTPVGAFS       420
     VDVTHSNVSI PDDKTYQGQS YRISWNKLFE NTSTSLNIAA YRYSTQHYLG LNDALTLIDE       480
     VEHPEQDLEP KSMRNYSRMK NQVTVSINQP LKFEKKDYGS FYLSGSWSDY WASGQNSTNY       540
     SIGYSNSASW GSYSISAQRS LNEDGQTDDS IYLSFTIPIE NLLDTDHRSS GFQSIDTQLN       600
     SDFKGNNQLN ISSSGYSDTN RISYSVNTGY MMNKSSDDLS YIGGHASYES PWGTLSCSAS       660
     ASSDNSRQFS LNTDGGFVLH SGGLTFSNDS FSDSDTLAVI QALGAKGARI NYGNSTVDRW       720
     SYGVTSALSP YHENRIALDI NDLENDVELK STSTVAIPRQ GAVVFADFET VQGQSAIMNI       780
     VRSDGKNIPF AEDIYDEQNN IIGNVGQGGQ AFVHGIEQEE NIRITWIEEG KPVSCFAHYQ       840
     QNTASEKIAQ SIILNGLRCQ IQ                                                862
//

If you have problems or comments...

PBIL Back to PBIL home page