(data stored in ACNUC7421 zone)

EMBL: FM180568.HUPB

FM180568.HUPB        Location/Qualifiers
FT   CDS             420356..420628
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="E2348C_0375"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07923"
FT                   /db_xref="GOA:B7UJR3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR3"
FT                   /protein_id="CAS07923.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     MNKSQLIDKI AAGADISKAA AGRALDAIIA SVTESLKEGD DVALVGFGTF AVKERAARTG        60
     RNPQTGKEIT IAAAKVPSFR AGKALKDAVN                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page