(data stored in ACNUC7421 zone)

EMBL: FM180568.ILVH

FM180568.ILVH        Location/Qualifiers
FT   CDS             93474..93965
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="E2348C_0083"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07631"
FT                   /db_xref="GOA:B7UIC8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIC8"
FT                   /protein_id="CAS07631.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     MRRILSVLLE NESGALSRVI GLFSQRGYNI ESLTVAPTDD PTLSRMTIQT VGDEKVLEQI        60
     EKQLHKLVDV LRVSELGQGA HVEREIMLVK IQASGYGRDE VKRNTEIFRG QIIDVTPSLY       120
     TVQLAGTSDK LDAFLASIRD VAKIVEVARS GVVGLSRGDK IMR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page