(data stored in ACNUC7421 zone)

EMBL: FM180568.IRAP

FM180568.IRAP        Location/Qualifiers
FT   CDS             360542..360802
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="E2348C_0318"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07866"
FT                   /db_xref="GOA:B7UJK6"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJK6"
FT                   /protein_id="CAS07866.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLRHPRQ"
     MKNLIAELLF KLAQKEEESK ELCAQVEALE IIVTAMLRNM AQNDQQRLID QVEGALYEVK        60
     PDASIPDDDT ELLRDYVKKL LRHPRQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page