(data stored in ACNUC7421 zone)

EMBL: FM180568.ISPH

FM180568.ISPH        Location/Qualifiers
FT   CDS             29189..30139
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="E2348C_0029"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   reductase, 4Fe-4S protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07577"
FT                   /db_xref="GOA:B7UI74"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UI74"
FT                   /protein_id="CAS07577.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDATDIQEEWVKEAKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
     MQILLANPRG FCAGVDRAIS IVENALAIYG APIYVRHEVV HNRYVVDSLR ERGAIFIEQI        60
     SEVPDGAILI FSAHGVSQAV RNEAKSRDLT VFDATCPLVT KVHMEVARAS RRGEESILIG       120
     HAGHPEVEGT MGQYSNPEGG MYLVESPDDV WKLTVKNEEK LSFMTQTTLS VDDTSDVIDA       180
     LRKRFPKIVG PRKDDICYAT TNRQEAVRAL AEQAEVVLVV GSKNSSNSNR LAELAQRMGK       240
     RAFLIDDATD IQEEWVKEAK CVGVTAGASA PDILVQNVVA RLQQLGGGEA IPLEGREENI       300
     VFEVPKELRV DIREVD                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page