(data stored in ACNUC7421 zone)

EMBL: FM180568.KDPC

FM180568.KDPC        Location/Qualifiers
FT   CDS             complement(653143..653715)
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="E2348C_0585"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08133"
FT                   /db_xref="GOA:B7UKX5"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKX5"
FT                   /protein_id="CAS08133.1"
FT                   /translation="MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAE
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     MRGLRPALST FLFLLLITGG VYPLLTTALG QWWFPWQANG SLIREGDTVR GSALIGQNFT        60
     GNGYFHGRPS ATAEMPYNPQ ASGGSNLAVS NPELDKQIAA RVAELRAANP DASTNVPVEL       120
     VTASASGLDN NITPQAAAWQ IPRVAKARNL SVEQLTQLIA KYSQQPLVKY IGQPVVNIVE       180
     LNLALDKLDE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page