(data stored in ACNUC7421 zone)

EMBL: FM180568.KDPD

FM180568.KDPD        Location/Qualifiers
FT   CDS             complement(650466..653150)
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="E2348C_0584"
FT                   /product="fused sensory histidine kinase KdpD in
FT                   two-component regulatory system with KdpE signal sensing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08132"
FT                   /db_xref="GOA:B7UKX4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKX4"
FT                   /protein_id="CAS08132.1"
FT                   /translation="MNNEPLRPDPDRLLEQAAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLKGLAVLPLKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDSRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSSQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGINAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
     MNNEPLRPDP DRLLEQAAAP HRGKLKVFFG ACAGVGKTWA MLAEAQRLRA QGLDIVVGVV        60
     ETHGRKDTAA MLKGLAVLPL KRQAYRGRHI SEFDLDAALA RRPALILMDE LAHSNAPGSR       120
     HPKRWQDIEE LLEAGIDVFT TVNVQHLESL NDVVSGVTGI QVRETVPDPF FDAADDVVLV       180
     DLPPDDLRQR LKEGKVYIAG QAERAIEHFF RKGNLIALRE LALRRTADRV DEQMRAWRGH       240
     PGEEKVWHTR DAILLCIGHN TGSEKLVRAA ARLASRLGSV WHAVYVETPA LHRLPEKKRR       300
     AILSALRLAQ ELGAETATLS DPAEEKAVVR YAREHNLGKI ILGRPASRRW WRRETFADRL       360
     ARIAPDLDQV LVALDEPPAR TINNAPDSRS FKDKWRVQIQ GCVVAAALCA VITLIAMQWL       420
     MAFDAANLVM LYLLGVVVVA LFYGRWPSVV ATVINVVSFD LFFIAPRGTL AVSDVQYLLT       480
     FAVMLTVGLV IGNLTAGVRY QARVARYREQ RTRHLYEMSK ALAVGRSSQD IAATSEQFIA       540
     STFHARSQVL LPDDNGKLQP LTHPQGMTPW DDAIAQWSFD KGLPAGAGTD TLPGVPYQIL       600
     PLKSGEKTYG LVVVEPGNLR QLMIPEQQRL LETFTLLVAN ALERLTLTAS EEQARMASER       660
     EQIRNALLAA LSHDLRTPLT VLFGQAEILT LDLASEGSPH ARQASEIRQH VLNTTRLVNN       720
     LLDMARIQSG GFNLKKEWLT LEEVVGSALQ MLEPGLSSPI NLSLPEPLTL IHVDGPLFER       780
     VLINLLENAV KYAGAQAEIG INAHVEGENL QLDVWDNGPG LPPGQEQTIF DKFARGNKES       840
     AVPGVGLGLA ICRAIVDVHG GTITAFNRPE GGACFRVTLP QQTAPELEEF HEDM             894
//

If you have problems or comments...

PBIL Back to PBIL home page