(data stored in ACNUC7421 zone)

EMBL: FM180568.LEUD

FM180568.LEUD        Location/Qualifiers
FT   CDS             complement(84966..85571)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="E2348C_0076"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07624"
FT                   /db_xref="GOA:B7UIC1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UIC1"
FT                   /protein_id="CAS07624.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVQANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIASYEEKQPAFMR"
     MAEKFIKHTG LVVPLDAANV DTDAIIPKQF LQKVTRTGFG AHLFNDWRFL DEKGQQPNPD        60
     FVLNFPQYQG ASILLARENF GCGSSREHAP WALTDYGFKV VIAPSFADIF YGNSFNNQLL       120
     PVKLSDAEVD ELFALVQANP GIHFDVDLEA QEVKAGEKTY RFTIDAFRRH CMMNGLDSIG       180
     LTLQHDDAIA SYEEKQPAFM R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page