(data stored in ACNUC7421 zone)

EMBL: FM180568.LIPB

FM180568.LIPB        Location/Qualifiers
FT   CDS             complement(590423..591064)
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="E2348C_0530"
FT                   /product="lipoyl-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08078"
FT                   /db_xref="GOA:B7UKS0"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKS0"
FT                   /protein_id="CAS08078.1"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
     MYQDKILVRQ LGLQPYEPIS QAMHEFTDTR DDSTLDEIWL VEHYPVFTQG QAGKAEHILM        60
     PGDIPVIQSD RGGQVTYHGP GQQVMYVLLN LKRRKLGVRE LVTLLEQTVV NTLAELGIEA       120
     HPRADAPGVY VGEKKICSLG LRIRRGCSFH GLALNVNMDL SPFLRINPCG YAGMEMAKIS       180
     QWKPEATTNN IAPRLLENIL ALLNNPDFEY ITA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page