(data stored in ACNUC7421 zone)

EMBL: FM180568.MBHA

FM180568.MBHA        Location/Qualifiers
FT   CDS             257206..257991
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="E2348C_0225"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07773"
FT                   /db_xref="GOA:B7UJC0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC0"
FT                   /protein_id="CAS07773.1"
FT                   /translation="MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPTHP
FT                   PKPATVAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIVRDAHMEANLEMEIV
FT                   PQGLRVLIKDDQNRNMFERGSAKIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKS
FT                   NIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMV
FT                   LTKSASDTLYQYFGQHGDKVVQPLVKKLDKQQVLSHRTR"
     MTTIKLIVNS VSKSERESII AALHGQSIFN GGGLSPLNKI SPTHPPKPAT VAVPEETEKK        60
     ARDVNEKTAL LKKKSATELG ELATSINTIV RDAHMEANLE MEIVPQGLRV LIKDDQNRNM       120
     FERGSAKIMP FFKTLLVELA PVFDSLDNKI IITGHTDAMA YKSNIYNNWN LSGDRALSAR       180
     RVLEEAGMPE DKVMQVSAMA DQMLLDAKNP QSAGNRRIEI MVLTKSASDT LYQYFGQHGD       240
     KVVQPLVKKL DKQQVLSHRT R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page