(data stored in ACNUC7421 zone)

EMBL: FM180568.METI

FM180568.METI        Location/Qualifiers
FT   CDS             complement(230923..231576)
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="E2348C_0204"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07752"
FT                   /db_xref="GOA:B7UJA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJA0"
FT                   /protein_id="CAS07752.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTISAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
     MSEPMMWLLV RGVWETLAMT FVSGFFGFVI GLPVGVLLYV TRPGQIIANA KLYRTISAIV        60
     NIFRSIPFII LLVWMIPFTR VIVGTSIGLQ AAIVPLTVGA APFIARMVEN ALLEIPTGLI       120
     EASRAMGATP MQIVRKVLLP EALPGLVNAA TITLITLVGY SAMGGAVGAG GLGQIGYQYG       180
     YIGYNATVMN TVLVLLVILV YLIQFAGDRI VRAVTRK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page