(data stored in ACNUC7421 zone)

EMBL: FM180568.MODA

FM180568.MODA        Location/Qualifiers
FT   CDS             708671..709444
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="E2348C_0640"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08188"
FT                   /db_xref="GOA:B7ULN6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN6"
FT                   /protein_id="CAS08188.1"
FT                   /translation="MARKWLNLFTGAALSFAVAGNALADEGKITVFAAASLTNAMQDIA
FT                   TQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTASRQTL
FT                   LGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDPHKKVEYPV
FT                   AVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTTK"
     MARKWLNLFT GAALSFAVAG NALADEGKIT VFAAASLTNA MQDIATQYKK EKGVDVVSSF        60
     ASSSTLARQI EAGAPADLFI SADQKWMDYA VDKKAIDTAS RQTLLGNSLV VVAPKASEQK       120
     DFTIDSKTNW TSLLNGGRLA VGDPEHVPAG IYAKEALQKL GAWDTLSPKL APAEDVRGAL       180
     ALVERNEAPL GIVYGSDAVA SKGVKVVATF PEDPHKKVEY PVAVVEGHNN ATVKAFYDYL       240
     KGPQAAEIFK RYGFTTK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page