(data stored in ACNUC7421 zone)

EMBL: FM180568.MODB

FM180568.MODB        Location/Qualifiers
FT   CDS             709444..710133
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="E2348C_0641"
FT                   /product="molybdate transport permease protein ModB;
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08189"
FT                   /db_xref="GOA:B7ULN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN7"
FT                   /protein_id="CAS08189.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGLSFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDIKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
     MILTDPEWQA VLLSLKVSSL AVLFSLPFGI FFAWLLVRCT FPGKALLDSV LHLPLVLPPV        60
     VVGYLLLVSM GRRGFIGERL YDWFGLSFAF SWRGAVLAAA VMSFPLMVRA IRLALEGVDI       120
     KLEQAARTLG AGRWRVFFTI TLPLTLPGII VGTVLAFARS LGEFGATITF VSNIPGETRT       180
     IPSAMYTLIQ TPGGESGAAR LCIISIALAM ISLLISEWLA RISRERAGR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page